DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and prss60.2

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:297 Identity:98/297 - (32%)
Similarity:139/297 - (46%) Gaps:67/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LNECGKQVTN-RIYGGEIAELDEFPWLALLVYNSNDYG---CSGALIDDRHILTAAHCVQGE--- 196
            ||.||:...| ||.||..|....:||...|  .|..||   |.|:||....:||||||:.|.   
Zfish    22 LNVCGQAPLNSRIVGGVNAPEGSWPWQVSL--QSPRYGGHFCGGSLISSEWVLTAAHCLPGVSES 84

  Fly   197 ------GVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKY 255
                  |.|.:||          |.|.             :.:.::|  ||.||..|.  ||...
Zfish    85 SLVVYLGRRTQQG----------VNTH-------------ETSRNVA--KIIVHSSYN--SNTND 122

  Fly   256 NDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFS------VSGWGRTDLFNKYFINIHSP 314
            ||||::||...|:|..::.|:||        .|:..::|      ::|||..    :..:|:.:|
Zfish   123 NDIALLRLSSAVTFNDYIRPVCL--------AAQNSVYSAGTSSWITGWGDV----QAGVNLPAP 175

  Fly   315 -IKLKLRIPYVSNENCTKILEGFGVRLGPKQICAG-GEFAKDTCAGDSGGPLMYFDRQHSRWVAY 377
             |..:..||.|:|:.|...| |.|. :....|||| .:..||||.||||||::  .|..:.|:..
Zfish   176 GILQETMIPVVANDRCNAQL-GSGT-VTNNMICAGLAKGGKDTCQGDSGGPMV--TRLCTVWIQA 236

  Fly   378 GVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRK 414
            |:.|:|: .|.....|.|||.|::|..||.|.:.|.:
Zfish   237 GITSWGY-GCADPNSPGVYTRVSQYQSWISSKISQNQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 89/276 (32%)
Tryp_SPc 150..409 CDD:238113 90/278 (32%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 89/276 (32%)
Tryp_SPc 34..267 CDD:238113 90/278 (32%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.