DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG11313

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:392 Identity:128/392 - (32%)
Similarity:180/392 - (45%) Gaps:64/392 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CDIPNETKRGVCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEVEQQVSEAQGSYESLVCCPAN 92
            |..||: :.|.|:.:..|.....|...:|....::.|:::.:|.|..|      |....|||..:
  Fly    24 CRNPNQ-RTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESRCLVSDQ------SDLPFVCCTPD 81

  Fly    93 GQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRI--QTVEPSSGFNLLNECGKQVT-NRIYGGE 154
             .||                    ...|.:....:  .|:.|....     ||..:. |:|..|.
  Fly    82 -TDY--------------------NTTRARPNDEVIHSTLLPDRSI-----CGGDIAYNQITKGN 120

  Fly   155 IAELDEFPWLALLVYNSND------YGCSGALIDDRHILTAAHCVQGEGVRDRQG----LKHVRL 209
            ...|.||.|:.||.|..:|      | |:|:||::|:::||||||.. ..|.|:|    ...|||
  Fly   121 ETVLTEFAWMVLLEYRPHDGQQLRTY-CAGSLINNRYVVTAAHCVSA-ATRARKGDVSFRVSVRL 183

  Fly   210 GEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVM 274
            ||.|.....||:..    .|....:.||.|:|.:|..:.  :...:||||:|||...|:::..:.
  Fly   184 GEHNTSAVVDCLNG----RCLPEPVQIAVEEIRIHESFG--TRLFWNDIALIRLAREVAYSPSIR 242

  Fly   275 PICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVR 339
            |:|||:.........||.|:|:|||||      ..:..||:|:|||:.||....|.:..... |.
  Fly   243 PVCLPSTVGLQNWQSGQAFTVAGWGRT------LTSESSPVKMKLRVTYVEPGLCRRKYASI-VV 300

  Fly   340 LGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTD 404
            ||...:||.|....|:|.||||||||.|  ....||..|:||:|. .||....|||||||..|..
  Fly   301 LGDSHLCAEGRSRGDSCDGDSGGPLMAF--HEGVWVLGGIVSFGL-NCGSRFWPAVYTNVLSYET 362

  Fly   405 WI 406
            ||
  Fly   363 WI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855 14/60 (23%)
Tryp_SPc 149..406 CDD:214473 102/266 (38%)
Tryp_SPc 150..409 CDD:238113 104/267 (39%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 14/60 (23%)
Tryp_SPc 116..367 CDD:238113 104/267 (39%)
Tryp_SPc 116..364 CDD:214473 102/265 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457306
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.