DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:271 Identity:76/271 - (28%)
Similarity:119/271 - (43%) Gaps:53/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 QVTNRIYGGEIAELDEFPWLALLVYNSN-DYGCSGALIDDRHILTAAHCVQG-EGVRDRQGLKHV 207
            ::..||..|..|...:.|::..|:::.| ::.|.|::|.:..:||||||..| .||....|.   
  Fly    33 KIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA--- 94

  Fly   208 RLGEFNVKTEPD---CIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSF 269
                 :::.:|.   .:...|::.               |..|.  |...:|||::||..| |.|
  Fly    95 -----SLRNQPQYTHWVGSGNFVQ---------------HHHYN--SGNLHNDISLIRTPH-VDF 136

  Fly   270 THFVMPICLPNKSEPLTLAEGQMFSVSGWGRT-DLFNKYFINIHSPIKLKLR---IPYVSNENCT 330
            .|.|..:.||:.::......|.....||||.| |         .||:...|:   :..:|..:|:
  Fly   137 WHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYD---------GSPLPDWLQAVDVQIMSQSDCS 192

  Fly   331 KILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAV 395
            :     ...|....||......|.||.|||||||:  ..:.:|.|  ||.|:..:....:|.|||
  Fly   193 R-----SWSLHDNMICINTNGGKSTCGGDSGGPLV--THEGNRLV--GVTSFVSSAGCQSGAPAV 248

  Fly   396 YTNVAEYTDWI 406
            ::.|..|.|||
  Fly   249 FSRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 74/265 (28%)
Tryp_SPc 150..409 CDD:238113 75/266 (28%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 74/265 (28%)
Tryp_SPc 38..262 CDD:238113 75/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.