DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:267 Identity:73/267 - (27%)
Similarity:106/267 - (39%) Gaps:45/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VTNRIYGGEIAELDEFPWLALLVYNSND--YGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVR 208
            :..||..|.:|...:.|::..:..|||.  :.|.|::|....:||||||..|   .|...|.:  
  Fly    37 IEGRITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAG---ADEASLYY-- 96

  Fly   209 LGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFV 273
             |..|       ..||.:.....:...|.|      |.|....    :|:|:|:..| |.|...|
  Fly    97 -GAVN-------YNEPAFRHTVSSENFIRY------PHYVGLD----HDLALIKTPH-VDFYSLV 142

  Fly   274 MPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRI---PYVSNENCTKILEG 335
            ..|.||:..:.....|......:|||.        |...|.:...||:   ..:|...|...   
  Fly   143 NKIELPSLDDRYNSYENNWVQAAGWGA--------IYDGSNVVEDLRVVDLKVISVAECQAY--- 196

  Fly   336 FGVRLGPKQ-ICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNV 399
            :|.....:. ||......|.||.|||||||:..:......:...|.:||   |.:.| ||.:|.|
  Fly   197 YGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYG---CQVGG-PAGFTRV 257

  Fly   400 AEYTDWI 406
            .:|.:||
  Fly   258 TKYLEWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 71/262 (27%)
Tryp_SPc 150..409 CDD:238113 72/263 (27%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 71/262 (27%)
Tryp_SPc 41..266 CDD:238113 72/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.