DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:80/269 - (29%)
Similarity:122/269 - (45%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 KQVTNRIYGGEIAELDEFPWLALLVYNSN-DYGCSGALIDDRHILTAAHCVQG-EGVRDRQGLKH 206
            |.:..||..|..|...:.|::..|:::.| ::.|.|::|.:..:||||||..| .||....|.  
  Fly    30 KDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA-- 92

  Fly   207 VRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTH 271
                  :::|:|   :..:::...|         |..|..|.  |...:|||::||..| |.|..
  Fly    93 ------SIRTQP---QYTHWVGSGD---------IIQHHHYN--SGNLHNDISLIRTPH-VDFWS 136

  Fly   272 FVMPICLPNKSEPLTLAEGQMFSVSGWGRT-DLFNKYFINIHSPIKLKLR---IPYVSNENCTKI 332
            .|..:.||:.::......|.....||||.| |         .||:...|:   :..:|..:|::.
  Fly   137 LVNKVELPSYNDRYQDYAGWWAVASGWGGTYD---------GSPLPDWLQSVDVQIISQSDCSRT 192

  Fly   333 LEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYT 397
            ..     |....||...:..|.||.|||||||:..|  .:|.|  ||.|:|......:|.|||::
  Fly   193 WS-----LHDNMICINTDGGKSTCGGDSGGPLVTHD--GNRLV--GVTSFGSAAGCQSGAPAVFS 248

  Fly   398 NVAEYTDWI 406
            .|..|.|||
  Fly   249 RVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 77/262 (29%)
Tryp_SPc 150..409 CDD:238113 78/263 (30%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 78/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.