DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG11843

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:324 Identity:106/324 - (32%)
Similarity:150/324 - (46%) Gaps:67/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LDVT---ARFKRKKLKRRIQTVEPSSGF---------NLLNECGKQVTNRIYGGEIAELDEFPWL 164
            :||.   :|:|:...:.||:     .||         .:::.| :..|..|.||..|:..|||.:
  Fly    24 MDVVGSCSRYKKSVFEERIE-----FGFLLPGASIESRIIDNC-RSYTPLIVGGHPAQPREFPHM 82

  Fly   165 ALLVYNSN-----DYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEP 224
            |.|....:     |:.|.|.||.:|.:||||||::.|    |..:..|||||.:.    |.::| 
  Fly    83 ARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESE----RGEVNVVRLGELDF----DSLDE- 138

  Fly   225 NYLSCADAA-LDIAYEKIHVHPEYK--EFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLT 286
                  ||| .|........||.|:  :|    |:||.:::|...|.|..:..|.|||.:.|   
  Fly   139 ------DAAPRDYMVAGYIAHPGYEDPQF----YHDIGLVKLTEAVVFDLYKHPACLPFQDE--- 190

  Fly   287 LAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKIL--------EGFGVRLGPK 343
             .....|...|||.|.|..|     .|...||:::....|..|.|:|        .||.   |..
  Fly   191 -RSSDSFIAVGWGSTGLALK-----PSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFD---GNN 246

  Fly   344 QICAGGEFAKDTCAGDSGGPLMYFDRQH-SRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            |:|.|.|.|:|||.|||||||:.:.|:: ..:|..|:.|.|.: ||..|.|.:||.|..|..||
  Fly   247 QLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLS-CGSPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 94/273 (34%)
Tryp_SPc 150..409 CDD:238113 96/274 (35%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 96/274 (35%)
Tryp_SPc 68..309 CDD:214473 94/272 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.