DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG11842

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:305 Identity:90/305 - (29%)
Similarity:128/305 - (41%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 FNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYNSN----DYGCSGALIDDRHILTAAHCVQGE 196
            :..|::| ......|.||..|...|||..|.|.:...    ::.|.|.||.|||:||||||....
  Fly    60 YKTLDKC-TSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSP 123

  Fly   197 GVRDRQGLKHV-RLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYK--YNDI 258
                 ||..:: |||:....|..|..:..::        |:  :....|||:    :|.  ||||
  Fly   124 -----QGSVNIARLGDLEFDTNNDDADPEDF--------DV--KDFTAHPEF----SYPAIYNDI 169

  Fly   259 AIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPY 323
            :::||..||:|..:..|.|||.....|    |..|...|||:.::                 :|.
  Fly   170 SVVRLSRPVTFNDYKHPACLPFDDGRL----GTSFIAIGWGQLEI-----------------VPR 213

  Fly   324 VSNENCTKI-LEGFGVRL---------------GPKQICAGGEFAKDTCAGDSGGPLMYFDRQH- 371
            ..|:...|: |..:|.|.               ...|:|.|....||||.||||||::.:...: 
  Fly   214 TENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYP 278

  Fly   372 SRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRKKS 416
            ..:...|:.|.| ..|.....||:||.|..|.|||.   ||..|:
  Fly   279 CMYHVMGITSIG-VACDTPDLPAMYTRVHFYLDWIK---QQLAKN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 83/280 (30%)
Tryp_SPc 150..409 CDD:238113 85/282 (30%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 85/285 (30%)
Tryp_SPc 73..312 CDD:214473 83/279 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.