DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and modSP

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:328 Identity:85/328 - (25%)
Similarity:123/328 - (37%) Gaps:92/328 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SSGFNLLN----------------------ECG------KQVTNRIYGGEIAELDEFPW-LALLV 168
            |:||..|:                      :||      ||.::   ||........|| :.|.|
  Fly   327 STGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSS---GGYTINNTVVPWHVGLYV 388

  Fly   169 -YNSNDY--GCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRL---------GEFNVKTEPDCI 221
             :|..||  .|.|:|:....::||||||..||.|........|:         ||    |.|   
  Fly   389 WHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGE----TTP--- 446

  Fly   222 EEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKS--EP 284
            ||..    .|..|      |.:.|.||..:...|.|:|::.|..|...:|.:.|||:...|  |.
  Fly   447 EEKR----RDVRL------IEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEK 501

  Fly   285 LTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNEN--CTKILEGFGVRLGPKQICA 347
            .::.:......:||           ||.:..:|:. :|.||..|  |.:.|..    :...:.|.
  Fly   502 ESVTDDVQGKFAGW-----------NIENKHELQF-VPAVSKSNSVCRRNLRD----IQADKFCI 550

  Fly   348 GGEFAKDTCAGDSGG------PLMYFDRQH-SRWVAYGVVSY--GFTQCGMAGKPAVYTNVAEYT 403
            ..:.....|.|||||      |...|...: :|...:||:|.  ...||  |....|.||:..:.
  Fly   551 FTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQC--AHSLTVMTNIQHFE 613

  Fly   404 DWI 406
            |.|
  Fly   614 DMI 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 76/282 (27%)
Tryp_SPc 150..409 CDD:238113 77/283 (27%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 4/26 (15%)
Tryp_SPc 371..616 CDD:214473 76/279 (27%)
Tryp_SPc 371..591 CDD:304450 68/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.