DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG9649

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:299 Identity:80/299 - (26%)
Similarity:130/299 - (43%) Gaps:57/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QTVEPSSGFNLLNECGKQ---VTNRIYGGEIAELDEFPWL-ALLVYNSNDYG--CSGALIDDRHI 186
            ||:...||.     ||::   .|..|:.|...|..:.||: ||..:...||.  |.|.||..|.:
  Fly   237 QTIGQLSGI-----CGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTV 296

  Fly   187 LTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIE-EPNYLSCADAALDIAYEKIHVHPEYKEF 250
            ::||||              .|.|..|:..|...:. ..|.|....:...:...::.:|.:|.. 
  Fly   297 ISAAHC--------------FRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNP- 346

  Fly   251 SNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPI 315
            :.|...|:|:::|.:.|....::.||||.|::..|.|..|....|:|||..:..|:         
  Fly   347 NVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNR--------- 402

  Fly   316 KLKLRIPYVSNENCTKILEGFGVR----------LGPKQICAGGEFAKDTCAGDSGGPLMYFDRQ 370
              ..|:..:::   |.|:..:..|          :....|||....|...|:|||||.||.  ::
  Fly   403 --NTRLAKMTD---TDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLML--QE 460

  Fly   371 HSRWVAYGVVSYG---FTQCGMAGKPAVYTNVAEYTDWI 406
            ...|:..||||.|   ..:|.:. .|.:||:||::.:|:
  Fly   461 QDIWMLRGVVSAGQRMTNRCNLT-LPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 72/273 (26%)
Tryp_SPc 150..409 CDD:238113 73/274 (27%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 72/272 (26%)
Tryp_SPc 259..497 CDD:214473 71/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.