DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and snk

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:429 Identity:113/429 - (26%)
Similarity:166/429 - (38%) Gaps:119/429 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ALAEVLQE---CDIPNETKRGVCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEVEQQVSEAQG 81
            :::|.|.|   |....:.:.|.|:...:|   |.|.....:...:::.     |.....|     
  Fly    82 SVSEGLHEGAFCRRSFDGRSGYCILAYQC---LHVIREYRVHGTRIDI-----CTHRNNV----- 133

  Fly    82 SYESLVCCPANGQDYLFPVLQFSKF-EYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNECGKQ 145
               .::|||...:..|...:..:|. ||            ....||:...:....|:     |||
  Fly   134 ---PVICCPLADKHVLAQRISATKCQEY------------NAAARRLHLTDTGRTFS-----GKQ 178

  Fly   146 VTNR---IYGGEIAELDEFPWLALLVY----NSND----YGCSGALIDDRHILTAAHC-VQGEGV 198
            ....   |.||.......||.:|.|.:    .|.|    :||.|||:.:.::|||||| ..|...
  Fly   179 CVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKP 243

  Fly   199 RDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRL 263
            .|.     ||||          ..:.|..|....  ||....|.:||:|:  |:..|:|||:::|
  Fly   244 PDM-----VRLG----------ARQLNETSATQQ--DIKILIIVLHPKYR--SSAYYHDIALLKL 289

  Fly   264 KHPVSFTHFVMPIC---LPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVS 325
            ...|.|:..|.|.|   ||....|..:|       :|||||:     |:...|....::.:..|.
  Fly   290 TRRVKFSEQVRPACLWQLPELQIPTVVA-------AGWGRTE-----FLGAKSNALRQVDLDVVP 342

  Fly   326 NENCTK-----------ILEGFGVRLGPKQICAG---GEFAKDTCAGDSGGPLMYFDRQHSRWVA 376
            ...|.:           |:||        |.|||   |  .:|||.||||||:      |:....
  Fly   343 QMTCKQIYRKERRLPRGIIEG--------QFCAGYLPG--GRDTCQGDSGGPI------HALLPE 391

  Fly   377 YGVVSY--GFTQ----CGMAGKPAVYTNVAEYTDWIDSV 409
            |..|::  |.|.    |.....|.|||.:..|.|||:.:
  Fly   392 YNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855 8/60 (13%)
Tryp_SPc 149..406 CDD:214473 87/291 (30%)
Tryp_SPc 150..409 CDD:238113 89/290 (31%)
snkNP_001097766.1 CLIP 93..139 CDD:197829 9/61 (15%)
Tryp_SPc 186..430 CDD:238113 89/290 (31%)
Tryp_SPc 186..427 CDD:214473 87/287 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.