DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG13318

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:262 Identity:89/262 - (33%)
Similarity:125/262 - (47%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 AELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDC 220
            |....:||.|.|:..::.|...||||..:|:|||||.|...|:.    ...|||||::..:..:.
  Fly   169 ASFGAYPWQAALLTTADVYLGGGALITAQHVLTAAHKVYNLGLT----YFKVRLGEWDAASTSEP 229

  Fly   221 IEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFT--HFVMPICLPNKSE 283
            |          .|.|:....::|:|.:.  .|...||:||::|..|||.|  ..|..:|||.   
  Fly   230 I----------PAQDVYISNVYVNPSFN--PNNLQNDVAILKLSTPVSLTSKSTVGTVCLPT--- 279

  Fly   284 PLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILE----GFGVRLGPKQ 344
              |...||...|:|||:.| |..  ...:..|:.::.:|.:.|.||...|:    |....|.|..
  Fly   280 --TSFVGQRCWVAGWGKND-FGA--TGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTS 339

  Fly   345 -ICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDS 408
             ||||||..||.|.||.|.||:.  ..:..|...|:|::|. .|..||.|.||.||..|..||.:
  Fly   340 FICAGGEAGKDACTGDGGSPLVC--TSNGVWYVVGLVAWGI-GCAQAGVPGVYVNVGTYLPWIQT 401

  Fly   409 VV 410
            .:
  Fly   402 TL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 87/256 (34%)
Tryp_SPc 150..409 CDD:238113 89/259 (34%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 89/259 (34%)
Tryp_SPc 169..399 CDD:214473 87/256 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.