DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG18223

DIOPT Version :10

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:41 Identity:12/41 - (29%)
Similarity:17/41 - (41%) Gaps:4/41 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FGFITADNVYHVTVYATDADGNFKIVSMKNYKLGP--TTLP 94
            |..:.|.....:.:...||.|  |...:...|||.  ||:|
  Fly     9 FSRLFAKKEMRILMVGLDAAG--KTTILYKLKLGEIVTTIP 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:463440 7/32 (22%)
Tryp_SPc 149..406 CDD:214473
CG18223NP_649077.1 Tryp_SPc 60..280 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.