DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG18223

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:120/270 - (44%) Gaps:70/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKH------VRLGEFNVKTEPDCIEEPNY 226
            ::..|.: |.|.:|...:|||:|||..     |::.:.|      |..|..|           ..
  Fly    72 LFGDNHF-CGGVIISRTYILTSAHCAM-----DKRKIVHRSRVLVVVAGTTN-----------RL 119

  Fly   227 LSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRL--KHPVSFTHFVMPICLPNKS-EPLTLA 288
            .|....:|::..:||.| |:  :|:.:..|:||::.|  |.|:. ...|..|.||... ||    
  Fly   120 KSRKGLSLNMEVKKIFV-PD--KFTVFNTNNIALMMLAKKLPLD-NPLVGVINLPTADPEP---- 176

  Fly   289 EGQMFSVSGWGR--------TDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQI 345
             |..::|.||||        :|:       :|..::|      :..:.|.|.:..|    ..:.:
  Fly   177 -GLNYTVLGWGRIFKGGPLASDI-------LHIDVEL------LPRDICEKKVHIF----KEEMM 223

  Fly   346 CAG---GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWID 407
            |||   ....::.||||:|.||::.:      ..:|||||. ..||....|::||||..:.|||:
  Fly   224 CAGNLNNTMDENPCAGDTGSPLIFNE------TVFGVVSYR-VGCGSKTLPSIYTNVYMHMDWIN 281

  Fly   408 SVVQQRKKSQ 417
            .::...:.::
  Fly   282 GIMNNNEANR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 69/257 (27%)
Tryp_SPc 150..409 CDD:238113 71/260 (27%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 71/260 (27%)
Tryp_SPc 60..280 CDD:214473 69/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.