DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG4613

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:269 Identity:85/269 - (31%)
Similarity:127/269 - (47%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKH 206
            ||....|||.||.....:::||:|.::..:..: |.|.||:||::|||||||.|   .|.:|:. 
  Fly   129 CGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLF-CGGTLINDRYVLTAAHCVHG---MDMRGVS- 188

  Fly   207 VRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTH 271
            |||.:.:        ....:|.   ....:|:  .|.|..|...|  ..:|||::||..|:....
  Fly   189 VRLLQLD--------RSSTHLG---VTRSVAF--AHAHVGYDPVS--LVHDIALLRLDQPIPLVD 238

  Fly   272 FVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGF 336
            .:.|.|||  |..|...:.|...|:|||.:.....     .|.:..::.:|.::|..|.  ...:
  Fly   239 TMRPACLP--SNWLQNFDFQKAIVAGWGLSQEGGS-----TSSVLQEVVVPIITNAQCR--ATSY 294

  Fly   337 GVRLGPKQICAG----GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYT 397
            ...:....:|||    |  .:|.|.|||||||:..||   .:...||||:|: .|.....|.|||
  Fly   295 RSMIVDTMMCAGYVKTG--GRDACQGDSGGPLIVRDR---IFRLAGVVSFGY-GCAKPDAPGVYT 353

  Fly   398 NVAEYTDWI 406
            .|:.|.:||
  Fly   354 RVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 80/260 (31%)
Tryp_SPc 150..409 CDD:238113 81/261 (31%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 80/260 (31%)
Tryp_SPc 137..362 CDD:238113 79/259 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.