DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG18179

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:299 Identity:84/299 - (28%)
Similarity:119/299 - (39%) Gaps:69/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 IQTVEPSSGFN---LLNECGKQVT------NRIYGGEIAELDEFPWLALLVY-----NSNDYGCS 177
            :..|..|.|||   ||    .|||      .||..|..|...:.|::..|:.     ||...| :
  Fly    12 LAVVAASPGFNRTSLL----PQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVG-A 71

  Fly   178 GALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIH 242
            |.:|....|||||||:..:.|....|......|.|......|     |::|              
  Fly    72 GTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRD-----NFIS-------------- 117

  Fly   243 VHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMF-----SVSGWGRTD 302
             ||.:.....   .||.:||.. .|.||..:..:.||:.||     |...|     ...|||..|
  Fly   118 -HPNWPAEGG---RDIGLIRTP-SVGFTDLINKVALPSFSE-----ESDRFVDTWCVACGWGGMD 172

  Fly   303 LFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYF 367
              |.   |:...::. :.:..:||..|.   :.:|. :....:|......|.:|.|||||||:..
  Fly   173 --NG---NLADWLQC-MDVQIISNSECE---QSYGT-VASTDMCTRRTDGKSSCGGDSGGPLVTH 227

  Fly   368 DRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            |  ::|.|  ||:::|...|...  |:.||.|.:|..||
  Fly   228 D--NARLV--GVITFGSVDCHSG--PSGYTRVTDYLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 72/266 (27%)
Tryp_SPc 150..409 CDD:238113 73/267 (27%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 72/266 (27%)
Tryp_SPc 40..263 CDD:238113 73/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.