DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG10469

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:272 Identity:78/272 - (28%)
Similarity:125/272 - (45%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RIYGGEIAELDEFPW-LALLVY--NSNDYG--CSGALIDDRHILTAAHCVQGEGVRDRQGLKHVR 208
            ||..|..|:..:.|: :.||.|  .|.|..  |.|.::.:|.|:|||||:|.    .:..|..|.
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQD----PKSNLWKVL 83

  Fly   209 LGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKY-NDIAIIRLKHPVSFTHF 272
            :....||:..|          .:..::.:|..:|     |:|..... ||||:|:|...::|..:
  Fly    84 IHVGKVKSFDD----------KEIVVNRSYTIVH-----KKFDRKTVTNDIALIKLPKKLTFNKY 133

  Fly   273 VMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFG 337
            :.|..||:..:..|   |:...:||||.|..      .:.|.:...:|.|.:||:.|.:   .:.
  Fly   134 IQPAKLPSAKKTYT---GRKAIISGWGLTTK------QLPSQVLQYIRAPIISNKECER---QWN 186

  Fly   338 VRLG--PKQICAGGEFAKDT-----CAGDSGGPLMYFDRQHSRWVAYGVVSYGFT-QCGMAGKPA 394
            .:||  .|::...|....|:     |.||||||::..|...:   ..|:||:||. :|.:. .|.
  Fly   187 KQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLDDGSRT---LVGIVSHGFDGECKLK-LPD 247

  Fly   395 VYTNVAEYTDWI 406
            |.|.|:.|..||
  Fly   248 VSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 76/270 (28%)
Tryp_SPc 150..409 CDD:238113 77/271 (28%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 76/270 (28%)
Tryp_SPc 24..260 CDD:238113 77/271 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.