DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG10472

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:122/279 - (43%) Gaps:60/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 TNRIYGGEIAELDEFPW-LALLVYNSNDYG-CSGALIDDRHILTAAHCVQG--------EGVRDR 201
            :.||.||:|||.::||: :.||:|.:.... |.|.:|.||.|:|||||...        .|..||
  Fly    44 SGRITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDR 108

  Fly   202 QGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHP 266
            .          |.|.|...|            :.:..:.:.||.::  .:....|||::|:|..|
  Fly   109 T----------NAKEEGQQI------------IFVETKNVIVHEDW--IAETITNDISLIKLPVP 149

  Fly   267 VSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGR--------TDLFNKYFINIHSPIKLKLRIPY 323
            :.|..::.|..||.||:..:...|:....||||:        ||:. :|           ..:|.
  Fly   150 IEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDIL-QY-----------ATVPI 202

  Fly   324 VSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCG 388
            ::|..|:...  ||: :....||........||.|||||||:..|..::   ..|..|:|.....
  Fly   203 MNNSGCSPWY--FGL-VAASNICIKTTGGISTCNGDSGGPLVLDDGSNT---LIGATSFGIALGC 261

  Fly   389 MAGKPAVYTNVAEYTDWID 407
            ..|.|.|:|.:..|.|||:
  Fly   262 EVGWPGVFTRITYYLDWIE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 78/274 (28%)
Tryp_SPc 150..409 CDD:238113 79/276 (29%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 78/274 (28%)
Tryp_SPc 47..282 CDD:238113 79/276 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.