DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:281 Identity:73/281 - (25%)
Similarity:109/281 - (38%) Gaps:76/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GKQVTNRIYGGEIAELDEFPWLALLVYNSNDYG---CSGALIDDRHILTAAHCVQGEGVRDRQGL 204
            |.::..||..|..|...:.|::..|.:::.:.|   |.|::|....:||||||..|         
  Fly    30 GNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYG--------- 85

  Fly   205 KHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYK----YNDIAIIRLKH 265
                               .:|::.:..|         |..:..:|::|.    :||||:||..|
  Fly    86 -------------------ASYVTISYGA---------VWRQQPQFTHYDTGNLHNDIALIRTPH 122

  Fly   266 PVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGW-------GRTDLFNKYFINIHSPIKLKLRIPY 323
             |.|...|..:.||...:......|....:|||       |.||..|...|.|.           
  Fly   123 -VDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQIS----------- 175

  Fly   324 VSNENCTKILEGFGVR-LGPKQICAGGEFAKDTCAGDSGGPLMYFD--RQHSRWVAYGVVSYGFT 385
             .|..|   |:.:|.. :....:|......|.:|:|||||||:..|  ||      .|:||:|..
  Fly   176 -DNSVC---LDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQ------VGIVSFGSA 230

  Fly   386 QCGMAGKPAVYTNVAEYTDWI 406
            ...::..|...|.|..|.|||
  Fly   231 AGCLSNSPKGLTRVTGYLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 70/273 (26%)
Tryp_SPc 150..409 CDD:238113 71/274 (26%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 70/273 (26%)
Tryp_SPc 37..254 CDD:238113 71/274 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.