DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:273 Identity:78/273 - (28%)
Similarity:112/273 - (41%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VTN---RIYGGEIAELDEFPWLALLVY--NSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLK 205
            |||   ||..|:.|...:||:...|.:  .|..:.|.|::||:..:||||||..|..........
  Fly    33 VTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGA 97

  Fly   206 HVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHP-VSF 269
            .||.....|:|    :...|::..|      :|..|.:.           |||::|  |.| |:|
  Fly    98 TVRTSAQLVQT----VSADNFVQHA------SYNSIVLR-----------NDISLI--KTPTVAF 139

  Fly   270 THFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPY-----VSNENC 329
            |..:..:.||..:...:...||....||||:|.         .|...:...:.|     ||...|
  Fly   140 TALINKVELPAIAGTYSTYTGQQAIASGWGKTS---------DSATSVANTLQYEVFEVVSVSQC 195

  Fly   330 TKILEGFGVRLGPKQ-ICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKP 393
            ...   :|..:.... ||........||.|||||||:..  ..|:.:  ||.|:..:....:|.|
  Fly   196 QNT---YGSLVATNNVICVATPNKVSTCNGDSGGPLVLV--SDSKLI--GVTSFVSSAGCESGAP 253

  Fly   394 AVYTNVAEYTDWI 406
            |.:|.|..|.|||
  Fly   254 AGFTRVTSYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 73/265 (28%)
Tryp_SPc 150..409 CDD:238113 74/266 (28%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 73/265 (28%)
Tryp_SPc 40..269 CDD:238113 74/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.