DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:311 Identity:84/311 - (27%)
Similarity:135/311 - (43%) Gaps:61/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RFLDVTA------RFKRKKLKRRIQTVEPSSGFNLLNECGKQVTNRIYGGEIAELDEFPW---LA 165
            :||.:.|      .|...:|:.|.:.: |..|         .:..||.||..|.:.:||:   |:
  Fly     2 KFLIILALAVAASAFPEPELRHRSREM-PVVG---------DIGGRITGGSNAAVGQFPYQVGLS 56

  Fly   166 LLVYNSNDYGCSGALIDDRHILTAAHCVQG-EGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSC 229
            |.:...:...|.|:||....:||||||..| :.|.       |.||. .|:|.            
  Fly    57 LKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVT-------VYLGA-TVRTS------------ 101

  Fly   230 ADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFS 294
            |:....::...|.:|..:.. :|.: |||::|::. ..|.:..:..:.||:.|...:...|.:..
  Fly   102 AEITHTVSSSDIIIHSGWNS-ANLR-NDISLIKIP-ATSSSSRISAVKLPSISNSYSTFVGDVAV 163

  Fly   295 VSGWGRTDLFNKYFINIHSPIKLKLR---IPYVSNENCTKILEGFGVR-LGPKQICAGGEFAKDT 355
            .||||||.       :..|.:...|:   :..::|   ||..:.:|.. :....:|.....||.|
  Fly   164 ASGWGRTS-------DTSSGVATNLQYVDLTVITN---TKCAQTYGTSVVTDSTLCVATTDAKST 218

  Fly   356 CAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            |.|||||||:.  :..|..:  |:.|:|.:.....|.||.:|.|..|.|||
  Fly   219 CNGDSGGPLVL--KSSSEQI--GLTSFGASAGCEKGYPAAFTRVTSYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 74/264 (28%)
Tryp_SPc 150..409 CDD:238113 75/265 (28%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 74/264 (28%)
Tryp_SPc 38..268 CDD:238113 75/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.