DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG10477

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:278 Identity:77/278 - (27%)
Similarity:107/278 - (38%) Gaps:66/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VTNRIYGGEIAELDEFPWLALLVYNSN--DYGCSGALIDDRHILTAAHCVQGEG---------VR 199
            :..||..|..|..::||:...|.:.|:  .:.|.|::|.:..:||||||.:|..         ||
  Fly    36 IDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVR 100

  Fly   200 DRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLK 264
            ....||.                            .::..|...|..|...:  ..|||::|  |
  Fly   101 TSAKLKK----------------------------KVSSSKFVQHAGYNAAT--LRNDISLI--K 133

  Fly   265 HP-VSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPY----- 323
            .| |:||..:..|.||..:...:...||....||||||.         .|.|.:...:.|     
  Fly   134 TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTS---------DSSIAVATNLQYAQFQV 189

  Fly   324 VSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCG 388
            ::|..|.|......|..|  .||......|.||.|||||||...:|      ..||.|:..::..
  Fly   190 ITNAVCQKTFGSSVVTSG--VICVESINKKSTCQGDSGGPLALNNR------LIGVTSFVSSKGC 246

  Fly   389 MAGKPAVYTNVAEYTDWI 406
            ....||.:|.|..|.|||
  Fly   247 EKNAPAGFTRVTSYLDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 75/273 (27%)
Tryp_SPc 150..409 CDD:238113 76/274 (28%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 75/273 (27%)
Tryp_SPc 40..267 CDD:238113 76/274 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.