DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG14990

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:294 Identity:82/294 - (27%)
Similarity:124/294 - (42%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CGKQVTNRIYGGEIAELD-----EFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDR 201
            ||....|.:........|     :|||:..| ::...|..:|:||....:||||..|.|:  .|.
  Fly    48 CGMSNPNGLVANVKVPKDYSTPGQFPWVVAL-FSQGKYFGAGSLIAPEVVLTAASIVVGK--TDA 109

  Fly   202 QGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKY----NDIAIIR 262
            :.:  ||.||:|..      :...:|...|..:....       :::|||   |    |:||::.
  Fly   110 EIV--VRAGEWNTG------QRSEFLPSEDRPVARVV-------QHREFS---YLLGANNIALLF 156

  Fly   263 LKHPVSFTHFVMPICLPNKSEPLTLAEGQMFS-----VSGWGRTDLFNKYFINIHSPIKLKLRIP 322
            |.:|......:..||||        ::|:.|.     |:|||:....::.:.||..    |:.:|
  Fly   157 LANPFELKSHIRTICLP--------SQGRSFDQKRCLVTGWGKVAFNDENYSNIQK----KIELP 209

  Fly   323 YVSNENCTKILE----GFGVRLGPKQICAGGEFAKDTCAGDSGGPLMY-FDRQHSRWVAYGVVSY 382
            .::...|...|.    |....|....||||||.....|.||.|..|.. .:...||:...|:|::
  Fly   210 MINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNW 274

  Fly   383 GFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRKKS 416
            |. .|.....|||||||..:.|||...:.|...|
  Fly   275 GI-GCQEENVPAVYTNVEMFRDWIYEHMAQNSNS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 75/275 (27%)
Tryp_SPc 150..409 CDD:238113 77/277 (28%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 76/266 (29%)
Tryp_SPc 67..297 CDD:214473 74/263 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.