DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG15873

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:258 Identity:72/258 - (27%)
Similarity:109/258 - (42%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 YNSNDYGCSGALIDDRHILTAAHCVQGEGVRDR-------QGLKHVRLGEFNVKTEPDCIEEPNY 226
            :..:::.|||.|:..|.:||||||     :.||       :|::.|    |...|.....:|.::
  Fly    62 HRGDNHFCSGVLVSSRAVLTAAHC-----LTDRYKASMNPRGIRVV----FGHITRLAVYDESDF 117

  Fly   227 LSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPV-SFTHFVMPICLPNKSEPLTLAEG 290
            .|         .:::.|||||:   .||.||:||:||...| |..|.|:|: |..|:..:|.  |
  Fly   118 RS---------VDRLVVHPEYE---RYKKNDLAILRLSERVQSSNHDVLPL-LMRKTANVTY--G 167

  Fly   291 QMFSVSGWGRTDLFNKYFINIHSP-------IKLKLRIPYVSNENCTKILEGFGVRLGPKQICAG 348
            ......|||:        |..|.|       :.:.||.|.:    |.|..:.|   .....:|..
  Fly   168 DTCITLGWGQ--------IYQHGPYSNELVYLDVILRPPSL----CQKHYDTF---TADHNVCTE 217

  Fly   349 GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQ 411
            .......||||.||||:      .:...:|::. |...|. .||...:.:...|.|||...:|
  Fly   218 PVGESMNCAGDMGGPLL------CKGALFGLIG-GHMGCA-GGKAMKFLSFLYYKDWILLTIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 69/251 (27%)
Tryp_SPc 150..409 CDD:238113 71/254 (28%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 64/233 (27%)
Tryp_SPc 59..250 CDD:238113 64/233 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.