DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG13527

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:278 Identity:64/278 - (23%)
Similarity:113/278 - (40%) Gaps:65/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RIYGGEIAELDEFPWLALLV---------YNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGL 204
            :.:|.|..||.::     :|         |..:::.|.|.|:.::.::||||||.|:     ..:
  Fly    31 KFHGDETLELAKY-----VVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQ-----SKI 85

  Fly   205 KHVRLGEFNVKTEPDCIE-EPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRL--KHP 266
            .:.......|...|..:. .|....|:..:      .::|.   |.|:.:...::|:::|  |.|
  Fly    86 MYKARWLLVVAGSPHRLRYTPGKSVCSPVS------SLYVP---KNFTMHNTFNMALMKLQEKMP 141

  Fly   267 -----VSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSN 326
                 :.|.|      ||.::..:    |...:|.||||........::|:     ::.:..:.|
  Fly   142 SNDPRIGFLH------LPKEAPKI----GIRHTVLGWGRMYFGGPLAVHIY-----QVDVVLMDN 191

  Fly   327 ENCTKILEGFGVRLGPKQICAGGE---FAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCG 388
            ..|......:    |...:|||..   ...:.|:||.|.||:      |..|..|:|:|.. .||
  Fly   192 AVCKTYFRHY----GDGMMCAGNNNWTIDAEPCSGDIGSPLL------SGKVVVGIVAYPI-GCG 245

  Fly   389 MAGKPAVYTNVAEYTDWI 406
            ....|:|||:|.....||
  Fly   246 CTNIPSVYTDVFSGLRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 62/276 (22%)
Tryp_SPc 150..409 CDD:238113 64/277 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/266 (23%)
Tryp_SPc 43..263 CDD:214473 58/264 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.