DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and tpr

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:315 Identity:101/315 - (32%)
Similarity:153/315 - (48%) Gaps:56/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 RRIQTVEPSSGFNLLNE--------CG-KQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGAL 180
            ||..|..|.:    ||.        || ..:..||.||:..|:.::||:|:|:|....| |:.:|
  Fly    97 RRATTPAPPT----LNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFY-CAASL 156

  Fly   181 IDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHP 245
            ::|:.:|||:|||.|    .|:....|||.|.:.|.        :::.    .:|....::..||
  Fly   157 LNDQFLLTASHCVYG----FRKERISVRLLEHDRKM--------SHMQ----KIDRKVAEVITHP 205

  Fly   246 EYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFIN 310
            :|.. .||. ||||||:|..||.|...:.|:|:|.   |....:|:...|:|||.        :.
  Fly   206 KYNA-RNYD-NDIAIIKLDEPVEFNEVLHPVCMPT---PGRSFKGENGIVTGWGA--------LK 257

  Fly   311 IHSPIK---LKLRIPYVSNENCTKILEGFGVRLGPKQICAG-GEFAKDTCAGDSGGPLMYF---D 368
            :..|..   .::::|.:|.:.|.|  ..:|.::....:|.| .|..||:|.|||||||...   .
  Fly   258 VGGPTSDTLQEVQVPILSQDECRK--SRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGT 320

  Fly   369 RQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRKKSQQTQDKM 423
            |:|.  :| ||||:| ..|..||.|.||..|..|..||.::.:|....||...|:
  Fly   321 REHQ--IA-GVVSWG-EGCAKAGYPGVYARVNRYGTWIKNLTKQACLCQQETKKI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 87/263 (33%)
Tryp_SPc 150..409 CDD:238113 88/265 (33%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 87/263 (33%)
Tryp_SPc 127..356 CDD:238113 88/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.