DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG30283

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:299 Identity:88/299 - (29%)
Similarity:129/299 - (43%) Gaps:74/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SGFNLLNECGKQVTN--RIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCV-QG 195
            ||..|.:.||....:  :|.||..|.:...||:| :|.....:.|.|.||.:|.:||:|||: .|
  Fly    25 SGSFLEHPCGTVPISQFKILGGHNAPVASAPWMA-MVMGEGGFHCGGTLITNRFVLTSAHCIANG 88

  Fly   196 EGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAI 260
            |       || ||||....:.|               |...|.:.:.||.:|    .:..:|:|:
  Fly    89 E-------LK-VRLGVLEREAE---------------AQKFAVDAMFVHTDY----YFDQHDLAL 126

  Fly   261 IRLKHPVSFTHFVMPICL------PNKSEPLTLAEGQMFSVSGWGRTD-------LFNKYFINIH 312
            :||...|.::..:.||||      .|..|.:.     .|...|||:|:       |......|:|
  Fly   127 LRLAKRVHYSDNISPICLLLDPLVKNIDEHIV-----KFRTYGWGKTESRSSSRMLQKTSLFNLH 186

  Fly   313 SPIKLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPL---MYFDRQHSRW 374
                         ...|.|  :....::....|||....| :||.|||||||   :.:|  |.:.
  Fly   187 -------------RSECAK--QYPHQQINRNHICAESANA-NTCNGDSGGPLTAIVTYD--HVQM 233

  Fly   375 V-AYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQ 412
            | .:||.|:|...|   .|..|:|||..:.|||.:.|::
  Fly   234 VFQFGVTSFGHADC---SKATVFTNVMTHLDWIVNTVRR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 80/274 (29%)
Tryp_SPc 150..409 CDD:238113 82/276 (30%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 80/274 (29%)
Tryp_SPc 43..266 CDD:238113 82/276 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.