DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and try-9

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:278 Identity:63/278 - (22%)
Similarity:102/278 - (36%) Gaps:80/278 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 SGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDC----IEEPNY----------- 226
            :|.|:...||:||||.:         |:....|        |||    :.|..:           
 Worm    29 TGTLVSPWHIVTAAHLI---------GISEDPL--------PDCDTGNLREAYFVRDYKNFVAFV 76

  Fly   227 -LSCA-----------DAALDIAYEKIHVHPEYKE---FSNYKYNDIAIIRLKHPVSFTHFVMPI 276
             ::||           |....:|.:.:::...|..   .....:||||:..|:.|:.|:..:.|.
 Worm    77 NVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPA 141

  Fly   277 CLPNKSE-PLTLAEGQMFSVSGWGR--TDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGV 338
            |||:..: |.....|  :.:.|:||  :|       ::....|||....:|:  .|:......||
 Worm   142 CLPSAPKIPRIRETG--YKLFGYGRDPSD-------SVLESGKLKSLYSFVA--ECSDDFPYGGV 195

  Fly   339 RLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYT 403
                  .|........:|.||||..::......:..|..||:|        ||.|.     .|..
 Worm   196 ------YCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGVLS--------AGMPC-----PELY 241

  Fly   404 DWIDSVVQQRKKSQQTQD 421
            |..:...|||::..|..|
 Worm   242 DTHNRQRQQRRQLTQETD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 58/261 (22%)
Tryp_SPc 150..409 CDD:238113 58/264 (22%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 55/248 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.