DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and scaf

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:428 Identity:102/428 - (23%)
Similarity:158/428 - (36%) Gaps:128/428 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RNATN--LPAEKVNFLKKVQCEVEQQVSEAQGSY---------------------------ESLV 87
            |..||  ||....|.:.:.:.:...|.|..:..|                           .:||
  Fly   285 RRPTNEYLPPAAANEIPRFEPDRAPQPSNQKPIYRGEDQLSPQIFPTPQPANVPKHFAKCASALV 349

  Fly    88 C-----CPANGQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSG------------ 135
            |     |.|.|.....|| :.|..|        |.| |..|...:||...|.|            
  Fly   350 CTSENFCNAIGVLSETPV-ELSPME--------AAF-RVPLTDCLQTENGSPGKCCRDPNYVDPW 404

  Fly   136 -FNLLNECGKQVTNRIYGGEIAELD----EFPWLALLV-YNSNDYGCSGALIDDRHILTAAHCVQ 194
             .||...|..: ..|.....:.:||    |.||.|::: .:|....|.||:|.|:.:|::|.||.
  Fly   405 PVNLAGVCATR-NKRTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVN 468

  Fly   195 GEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIA 259
            |..|.|.:    |:.||:.:.:..:.:  |..|:        ..:.:.|||:|...:|  .:|:|
  Fly   469 GLPVTDIR----VKAGEWELGSTNEPL--PFQLT--------GVKTVDVHPDYDPSTN--SHDLA 517

  Fly   260 IIRLKHPVSFTHFVMPICL----PNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSP---IKL 317
            ||||:..:.|...:.|||:    |..||       |.|: ||||      |..::||..   :.:
  Fly   518 IIRLERRLEFASHIQPICISDEDPKDSE-------QCFT-SGWG------KQALSIHEEGALMHV 568

  Fly   318 KLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSY 382
            ...:|...:| |:         .....:|:..:|  |:|..|.|..|........|  ..|:.: 
  Fly   569 TDTLPQARSE-CS---------ADSSSVCSATKF--DSCQFDVGSALACGSGSSVR--LKGIFA- 618

  Fly   383 GFTQCGMA-----GKPAVYTNVAEYTDWIDSVVQQRKK 415
            |...||..     .||.:        .||::...:..|
  Fly   619 GENSCGEGQTVRFAKPDI--------KWINTAFAENNK 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855 12/70 (17%)
Tryp_SPc 149..406 CDD:214473 69/273 (25%)
Tryp_SPc 150..409 CDD:238113 70/275 (25%)
scafNP_610180.1 FtsK <198..>334 CDD:332908 9/48 (19%)
Tryp_SPc 428..616 CDD:238113 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.