DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG17572

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:286 Identity:93/286 - (32%)
Similarity:144/286 - (50%) Gaps:32/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PSSGFNLLNECGKQ-VTNRIYGGEIAELDEFPWLALLVYNSND-----YGCSGALIDDRHILTAA 190
            |||.......|||. |....|.|    |..:|::|.:.:...:     |.|:||:|..|.|||||
  Fly   114 PSSPLEKNQVCGKSLVQGHFYKG----LGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAA 174

  Fly   191 HCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKY 255
            ||...:.  |...|..||:||::..::|||   .|...||..:::.|...:.|||:||: ..| :
  Fly   175 HCALAKA--DGHRLSSVRVGEYDTSSDPDC---ANTGFCAPRSVNHAISHVIVHPDYKQ-GQY-H 232

  Fly   256 NDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLR 320
            :|||::.||.|::::....||||  :.....|..|:..:::|||:...     .::..|....|.
  Fly   233 HDIALLVLKTPLNYSVATQPICL--QKTRANLVVGKRATIAGWGKMST-----SSVRQPEMSHLD 290

  Fly   321 IPYVSNENCTKILEGFGVRLGPKQI-----CAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVV 380
            :|..|.:.|.:.....|....|..|     ||||| .||.|.|..|.||  |.:::..:...|::
  Fly   291 VPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGE-GKDVCQGFGGAPL--FIQENGIFSQIGIM 352

  Fly   381 SYGFTQCGMAGKPAVYTNVAEYTDWI 406
            |:|...||....|:|||:||.:::||
  Fly   353 SFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 84/266 (32%)
Tryp_SPc 150..409 CDD:238113 86/267 (32%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 83/258 (32%)
Tryp_SPc 138..378 CDD:214473 81/256 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.