DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and SPH93

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:292 Identity:85/292 - (29%)
Similarity:140/292 - (47%) Gaps:49/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QTVEPSSGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAH- 191
            :.:.||.|.:  |..|.|:...|...: |...::|| |:.::::..|...|:||....:||.|| 
  Fly   227 ELLSPSCGMS--NANGLQMVEGITIDQ-ARPAQYPW-AVAIFHNGQYLAGGSLIQPNVVLTVAHR 287

  Fly   192 --CVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYK 254
              .::.|.|        ||.|::::|::.:.     :||   ...::....||...::|..:   
  Fly   288 VITIETELV--------VRAGDWDLKSDREI-----FLS---EQREVERAVIHEGFDFKSGA--- 333

  Fly   255 YNDIAIIRLKHPVSFTHFVMPICL--PNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKL 317
             |::|::.|..|......:..|||  ||||     ..|:..:|:|||:.    :|....:|.:..
  Fly   334 -NNLALLFLNSPFKLNDHIRTICLPTPNKS-----FAGRRCTVAGWGKM----RYEDQRYSTVLK 388

  Fly   318 KLRIPYVSNENCTKILEGFGVRLG-----PKQ-ICAGGEFAKDTCAGDSGGPLM--YFDRQHSRW 374
            |:::..|:...|.|.|.  ..|||     ||. ||||||..:|||.||.|..|.  ........:
  Fly   389 KVQLLVVNRNVCEKFLR--STRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVY 451

  Fly   375 VAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            ...|:|::| ..||..|.||:||.|:::|:||
  Fly   452 EQAGIVNWG-VGCGQEGIPAIYTEVSKFTNWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 77/269 (29%)
Tryp_SPc 150..409 CDD:238113 79/270 (29%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 78/267 (29%)
Tryp_SPc 252..482 CDD:214473 76/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.