DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG4793

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:386 Identity:101/386 - (26%)
Similarity:153/386 - (39%) Gaps:87/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEVEQQVSEAQGSYESLVCCPANGQDYLFPVLQF 103
            |::.:||:    :...|..|......|.          :..||......|||..      .:||:
  Fly    29 CVQRNRCR----IGTETGRPIIDFRGLN----------NGNQGCESGQTCCPKT------EILQY 73

  Fly   104 SKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFN--LLNECGKQVTNRIYGG-------EIAELD 159
                                        |....|  |..|||.  .|||..|       :||:..
  Fly    74 ----------------------------PVQADNQPLPTECGH--VNRIGVGFTITNARDIAQKG 108

  Fly   160 EFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEP 224
            |.||:..|:.:.:.....|..:..|.::..:.....| |.::..:  ||.||::.::    |.|.
  Fly   109 ELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLE-VPEKYLI--VRAGEWDFES----ITEE 166

  Fly   225 NYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAE 289
            .      |..|:|..||..|......:.  .|:.|::.|..|:...|.:..||||..:....   
  Fly   167 R------AHEDVAIRKIVRHTNLSVENG--ANNAALLFLARPLKLDHHIGLICLPPPNRNFI--- 220

  Fly   290 GQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEG-FG--VRLGPKQICAGGEF 351
            .....|||||:....:..::||   :| |:.:|.|....|...|:| :|  ..|....||||||.
  Fly   221 HNRCIVSGWGKKTALDNSYMNI---LK-KIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEP 281

  Fly   352 AKDTCAGDSGGPLMY-FDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQ 411
            .||||.||.|.||.. .....:|:...|:|::|| .|| ...||.||:|::...|||:.:|
  Fly   282 GKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGF-GCG-GPLPAAYTDVSQIRSWIDNCIQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855 8/49 (16%)
Tryp_SPc 149..406 CDD:214473 77/267 (29%)
Tryp_SPc 150..409 CDD:238113 79/269 (29%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 75/255 (29%)
Tryp_SPc 105..335 CDD:214473 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.