DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG4650

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:312 Identity:84/312 - (26%)
Similarity:127/312 - (40%) Gaps:75/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PSSGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGE 196
            |.|...|...|| .:||    |:||.....||:|.|..:...|.|.|.:|.::.:||||||    
  Fly    18 PGSSQYLDGRCG-LLTN----GKIANNISSPWMAYLHTSELLYVCGGTVITEKLVLTAAHC---- 73

  Fly   197 GVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAAL-DIAYEKIHVHPEYKEFSNYKYNDIAI 260
             .|..:.|. .|:||| :.|:          ...|..| :....:..:|..|.  :....|||||
  Fly    74 -TRASEQLV-ARIGEF-IGTD----------DANDTMLSEYQVSQTFIHSLYN--TTTSANDIAI 123

  Fly   261 IRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVS 325
            :.|...:.|:..:.|||                 :..|   .::.||..||......:..:|...
  Fly   124 LGLATDIVFSKTIRPIC-----------------IVWW---TIWRKYIDNIQVLSGAQWGLPNDR 168

  Fly   326 NENCTKILEGF---GVRLGPKQICA--GGE--FAKDTCAGDSGGPLMYFD-----------RQHS 372
            ||:     :.|   .:|..|..:|:  .|.  .:...|||||...|...|           :...
  Fly   169 NES-----DAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQ 228

  Fly   373 RWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRK---KSQQTQD 421
            |:|..|:.:.. .:|..|   :|||:|..:||:|.||.:|.:   ||.:|.|
  Fly   229 RYVLIGIATTN-QKCKRA---SVYTDVLSHTDFILSVWRQYRNGEKSPKTWD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 69/275 (25%)
Tryp_SPc 150..409 CDD:238113 70/277 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 70/276 (25%)
Tryp_SPc 33..258 CDD:304450 70/276 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.