DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:281 Identity:77/281 - (27%)
Similarity:110/281 - (39%) Gaps:71/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VTNRIYGGEIAELDEFPWLALLVYNSNDYG--CSGALIDDRHILTAAHCVQGE-------GVRDR 201
            :..||..|..|...:.|::..|.::|:..|  |.|::|....::|||||..|.       |...|
  Fly    39 IEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWR 103

  Fly   202 ---QGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRL 263
               |....|..|.|                             ..|.:|.  :|...|||::|..
  Fly   104 LQAQYTHTVGSGHF-----------------------------RQHSDYN--TNNLNNDISLINT 137

  Fly   264 KHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGR-------TDLFNKYFINIHSPIKLKLRI 321
            .| |.|.|.:..:.||:.:|......|.....|||||       :|..|    .:.|.|      
  Fly   138 PH-VDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLN----CVDSQI------ 191

  Fly   322 PYVSNENCTKILEGFGVR-LGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFT 385
              ::.:.|:.:   :|.. :....||......|.||||||||||:..||  |:.|  ||.|:...
  Fly   192 --ITRDECSSV---YGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDR--SKLV--GVTSFVAA 247

  Fly   386 QCGMAGKPAVYTNVAEYTDWI 406
            ....:|.|..:|.|..|.|||
  Fly   248 SGCTSGLPDGFTRVTSYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 75/276 (27%)
Tryp_SPc 150..409 CDD:238113 76/277 (27%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 75/276 (27%)
Tryp_SPc 43..271 CDD:238113 76/277 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.