DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:276 Identity:72/276 - (26%)
Similarity:102/276 - (36%) Gaps:71/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 QVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRL 209
            ::..||..|..|...:.|:...|.: |..:.|.|::|....:|||.||:                
  Fly    32 KIEGRITNGYAAPEGKAPYTVGLGF-SGGWWCGGSIIAHDWVLTAEHCI---------------- 79

  Fly   210 GEFNVKTEPDCIEEPNYLSCADAALDIAY--EKIHVHPEYK------EFSNYKYNDIAIIRLKHP 266
                                .|||..|.|  .....:.::.      .|..:...|||:||:.| 
  Fly    80 --------------------GDAASVIVYFGATWRTNAQFTHTVGNGNFIKHSNADIALIRIPH- 123

  Fly   267 VSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRT-DLFNKYFINIHSPIKLKLR---IPYVSNE 327
            |.|.|.|..:.||:.::.............|||.| |         .||:...|:   :..|.||
  Fly   124 VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYD---------GSPLPDWLQCVDLQIVHNE 179

  Fly   328 NCTKILEG--FGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMA 390
            .|     |  :| .:|...||......|..|.|||||||:..|......|:..|.|.|   | .:
  Fly   180 EC-----GWTYG-SVGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNG---C-QS 234

  Fly   391 GKPAVYTNVAEYTDWI 406
            |.||.:..|..:.|||
  Fly   235 GAPAGFQRVTYHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 70/270 (26%)
Tryp_SPc 150..409 CDD:238113 71/271 (26%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 70/270 (26%)
Tryp_SPc 37..253 CDD:238113 71/271 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.