DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG3355

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:324 Identity:93/324 - (28%)
Similarity:149/324 - (45%) Gaps:55/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LQFSKFEY--------RRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNE-----CGKQVTNRIYG 152
            |..::::|        ::|.||....  ...::.|:.|.|....|....     ||....|||.|
  Fly    16 LSLAQYQYQAPHQTLAQQFADVVDVV--DPAEQSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVG 78

  Fly   153 GEIAELDEFPWLALLVYNSNDYG---CSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNV 214
            |:....:::||.|.|| ....|.   |.|:||:||::|||||||.|.  ||:..::.:::..   
  Fly    79 GQQVRSNKYPWTAQLV-KGRHYPRLFCGGSLINDRYVLTAAHCVHGN--RDQITIRLLQIDR--- 137

  Fly   215 KTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLP 279
                         |..|..:.....:..|||.|.  .|...||:|:::|:.||..|..:.|:|||
  Fly   138 -------------SSRDPGIVRKVVQTTVHPNYD--PNRIVNDVALLKLESPVPLTGNMRPVCLP 187

  Fly   280 NKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQ 344
            ..:...   :|:...|:|||   |..:.  .:.|....::.:|.::|..|.:  ..:..::....
  Fly   188 EANHNF---DGKTAVVAGWG---LIKEG--GVTSNYLQEVNVPVITNAQCRQ--TRYKDKIAEVM 242

  Fly   345 ICAG--GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            :|||  .:..||.|.|||||||:.   ...|:...||||:|: .|.....|.||..|:::.|||
  Fly   243 LCAGLVQQGGKDACQGDSGGPLIV---NEGRYKLAGVVSFGY-GCAQKNAPGVYARVSKFLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 79/261 (30%)
Tryp_SPc 150..409 CDD:238113 80/262 (31%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 79/261 (30%)
Tryp_SPc 76..305 CDD:238113 80/262 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.