DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and prss60.3

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:297 Identity:100/297 - (33%)
Similarity:143/297 - (48%) Gaps:67/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LNECGKQVTN-RIYGGEIAELDEFPWLALLVYNSNDYG---CSGALIDDRHILTAAHCVQGE--- 196
            ||.||:...| ||.||..|....:||...|  :|..||   |.|:||....:||||||:.|.   
Zfish    24 LNVCGQAPLNTRIVGGVNASPGSWPWQVSL--HSPKYGGHFCGGSLISSEWVLTAAHCLSGVSET 86

  Fly   197 ------GVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKY 255
                  |.|.:||:        |:           |.:..:.|      |..||..|.  ||...
Zfish    87 TLVVYLGRRTQQGI--------NI-----------YETSRNVA------KSFVHSSYN--SNTND 124

  Fly   256 NDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFS------VSGWGRTDLFNKYFINIHSP 314
            ||||::||...|:||:::.|:||        .|:..::|      ::|||  |:  :..:|:.:|
Zfish   125 NDIALLRLSSAVTFTNYIRPVCL--------AAQNSVYSAGTSSWITGWG--DI--QAGVNLPAP 177

  Fly   315 -IKLKLRIPYVSNENCTKILEGFGVRLGPKQICAG-GEFAKDTCAGDSGGPLMYFDRQHSRWVAY 377
             |..:..||.|:|:.|..:| |.|. :....|||| .:..||||.||||||::  .|..:.||..
Zfish   178 GILQETMIPVVANDRCNALL-GSGT-VTNNMICAGLTQGGKDTCQGDSGGPMV--TRLCTVWVQA 238

  Fly   378 GVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRK 414
            |:.|:|: .|.....|.|||.|::|..||.|.:...|
Zfish   239 GITSWGY-GCADPNSPGVYTRVSQYQSWISSKISLNK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 91/276 (33%)
Tryp_SPc 150..409 CDD:238113 92/278 (33%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 92/278 (33%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.