DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG18557

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:423 Identity:106/423 - (25%)
Similarity:164/423 - (38%) Gaps:141/423 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CFYRFLALAEVLQECDIPNETKRGVCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEVEQQVSE 78
            ||:   .|.|....|.:..|     |:....||.....:||.:.|:         .|    |.||
  Fly    11 CFW---TLTETGAPCGLQME-----CVPQGLCKTSAWNQNAISWPS---------PC----QRSE 54

  Fly    79 AQGSYESLVCCPANGQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNECG 143
            :        ||.::                                :::....|      || ||
  Fly    55 S--------CCHSS--------------------------------QKLVIGAP------LN-CG 72

  Fly   144 KQVTNRIYGGEIAEL------DEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRD-- 200
            |...|.: ||.:.|:      :||||...|:.|..::..:|.|:.:..::||||.:..:.:.|  
  Fly    73 KSNPNGL-GGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFG 136

  Fly   201 ----RQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAII 261
                ...||.:.......:|.                     .:|..||::.:.:.  .|:||:|
  Fly   137 IIGGAWDLKQLAGKTIQWRTA---------------------TRIVSHPDFNKMTG--ANNIALI 178

  Fly   262 RLKHPVSFTHFVM-----PICLPNKSEPLTLAEGQMFS-----VSGWGRTDLFNKYFINIHSPIK 316
            .|:     |.|||     |||.|        ..|..|.     |:||||.|...|.:    |..:
  Fly   179 VLE-----TSFVMKPPIGPICWP--------TSGVSFDRERCLVAGWGRPDFLAKNY----SYKQ 226

  Fly   317 LKLRIPYVSNENC------TKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQH-SRW 374
            .|:.:|.||..:|      |..::.|  :|.|..:|||||..:|.|.||.|.|||.....| :.:
  Fly   227 KKIDLPIVSRSDCESLLRRTAFVQSF--QLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIY 289

  Fly   375 VAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWID 407
            ...|:|:.||: ||:...||:|||::....||:
  Fly   290 ELVGIVNSGFS-CGLENVPALYTNISHMRPWIE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855 12/60 (20%)
Tryp_SPc 149..406 CDD:214473 79/285 (28%)
Tryp_SPc 150..409 CDD:238113 81/287 (28%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 78/277 (28%)
Tryp_SPc 90..320 CDD:214473 76/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.