DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG4259

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:113/282 - (40%) Gaps:68/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 QVTNRIYGGEIAELDEFPWLALLVYNSND----YGCSGALIDDRHILTAAHCVQGEGVRDRQGLK 205
            |:....||..  ....|||: :.|.:..|    |...|:||:...:|||||.:.|....|..   
  Fly    25 QIRRETYGSN--PRATFPWV-VSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLV--- 83

  Fly   206 HVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFT 270
             ||.||::..|..|           ...:|:....|..|.::..|:  ..|::|::.|......|
  Fly    84 -VRAGEWDTSTTAD-----------QQHVDLEVLNIVSHEQFNRFN--AENNMALLILVSAFEMT 134

  Fly   271 HFVMPICLPNKSEPLTLAE-----GQMFSVSGWGRTDLFNKYFINIHSPIKLK-LRIPYVSNENC 329
            ..:..|       ||.|.|     |..| .:|||:.     |..:...|..|| :::..:|...|
  Fly   135 ANINLI-------PLYLQEAGIQKGSCF-FNGWGKV-----YLNSTDYPTVLKTVQVDLLSMGMC 186

  Fly   330 TKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCG----MA 390
            :      ..:|..:|||..|....| |:||.|.||:      .|.:.|   .|.:.|.|    ::
  Fly   187 S------SRKLPIQQICGKGLEGID-CSGDGGAPLV------CRILTY---PYKYAQVGIVNWLS 235

  Fly   391 GKPA-----VYTNVAEYTDWID 407
            .||.     |:||||....|||
  Fly   236 QKPVENTFIVFTNVAGLLPWID 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 72/275 (26%)
Tryp_SPc 150..409 CDD:238113 75/277 (27%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 73/266 (27%)
Tryp_SPc 39..256 CDD:214473 70/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.