DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Hayan

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:287 Identity:93/287 - (32%)
Similarity:133/287 - (46%) Gaps:52/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GKQVTNRIYGGEIAELDEFPWLALLVYNSNDYG-----CSGALIDDRHILTAAHCVQGEGVRDRQ 202
            ||.:|..|..||..:...:|.:|.:.|||  :|     |.|:||..|.:|||||||..    |..
  Fly   378 GKPLTVHILDGERVDRGVYPHMAAIAYNS--FGSAAFRCGGSLIASRFVLTAAHCVNS----DDS 436

  Fly   203 GLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPV 267
            ....||||..|::.     .||.|       .||....:.:||:|...|  ||.||||::|....
  Fly   437 TPSFVRLGALNIEN-----PEPGY-------QDINVIDVQIHPDYSGSS--KYYDIAILQLAEDA 487

  Fly   268 SFTHFVMPICL-PNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTK 331
            ..:..:.|.|| .::|:|   .....:.|:|||..::.|:..    |.|.|:..:..|..:.|. 
  Fly   488 KESDVIRPACLYTDRSDP---PANYKYFVAGWGVMNVTNRAV----SKILLRAALDLVPADECN- 544

  Fly   332 ILEGFG--------VRLG--PKQICAGGE-FAKDTCAGDSGGPL-MYFDRQHSRWVAYGVVSYGF 384
              ..|.        :|.|  ..|:||..: ..||.|.||||||| :..|.....:...||:|.||
  Fly   545 --ASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGF 607

  Fly   385 TQCGMAGK-PAVYTNVAEYTDWIDSVV 410
               |.|.| |.:||.|:.:.|:|:.:|
  Fly   608 ---GCATKTPGLYTRVSSFLDYIEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 88/275 (32%)
Tryp_SPc 150..409 CDD:238113 89/277 (32%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 88/275 (32%)
Tryp_SPc 385..630 CDD:238113 89/277 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.