DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG4653

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:242 Identity:59/242 - (24%)
Similarity:93/242 - (38%) Gaps:51/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 CSGALIDDRHILTAAHCVQGEGVRDRQGLK--HVRLGEFNVKTEPDCIEEPNYLSCADAALDIAY 238
            |.||||.::.||||||||...|.:.....|  :||:|.....|....               :..
  Fly    50 CGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQL---------------VPL 99

  Fly   239 EKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDL 303
            .||.:|..|........||:|::.|:..|.......||.|..:..    |.|.....||||.:.:
  Fly   100 SKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERP----AAGSQIIFSGWGSSQV 160

  Fly   304 FNKYFINIHSPIKLKLRIP------YVSNEN--CTKILEGFGVRLGPKQICAGGEFAKDTCAGDS 360
            .......:....:..|...      |:..|:  |          |.|    ...:|| ..|:||:
  Fly   161 DGSLSHVLQVATRQSLSASDCQTELYLQQEDLLC----------LSP----VDEDFA-GLCSGDA 210

  Fly   361 GGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWID 407
            |.|..|.::      ..|:.::..:.|| :.:|..|.:|.::.:||:
  Fly   211 GAPASYNNQ------LVGIAAFFVSGCG-SEQPDGYVDVTQHLEWIN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 57/239 (24%)
Tryp_SPc 150..409 CDD:238113 59/242 (24%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 59/242 (24%)
Tryp_SPc 30..249 CDD:214473 57/239 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.