DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG8952

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:280 Identity:76/280 - (27%)
Similarity:129/280 - (46%) Gaps:44/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 FNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYNS-NDYGCSGALIDDRHILTAAHCVQGEGVR 199
            |:..|....::.|||..|..|:|.:|||..:|..:: :|..|.|::|.|..:||||||.      
  Fly    24 FDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCT------ 82

  Fly   200 DRQGLKHVRL-----GEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIA 259
              .||..:.|     ..||..                 ||::....|.:||:|.:..|   ||::
  Fly    83 --NGLSSIFLMFGTVDLFNAN-----------------ALNMTSNNIIIHPDYNDKLN---NDVS 125

  Fly   260 IIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYV 324
            :|:|..|::|:..:..|.|..:........|.:.:::|:|.|:  ::|.  .:|...|..::..:
  Fly   126 LIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTE--DEYL--DYSETLLYAQVEII 186

  Fly   325 SNENCTKILEGFGVRLGPKQICAGGEFAKD--TCAGDSGGPLMYFDRQHSRWVAYGVVSY-GFTQ 386
            .|.:|..|...:.|  ....:||.|....|  ||.|||||||:.:::...:|...|:.|: ...|
  Fly   187 DNADCVAIYGKYVV--VDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQ 249

  Fly   387 CGMAGKPAVYTNVAEYTDWI 406
            |... .|:.|..|:.:..:|
  Fly   250 CTYR-LPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 72/265 (27%)
Tryp_SPc 150..409 CDD:238113 72/266 (27%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 72/265 (27%)
Tryp_SPc 38..271 CDD:238113 72/266 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.