DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG31827

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:267 Identity:76/267 - (28%)
Similarity:116/267 - (43%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 EFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLG--EFNVKTEPDCIE 222
            ||||...:::|.:..| .|:||....:|||||.:..:.|.|..    |..|  |:....|....|
  Fly    54 EFPWTIAVIHNRSLVG-GGSLITPDIVLTAAHRIFNKDVEDIV----VSAGEWEYGSALEKYPFE 113

  Fly   223 EPNYLSCADAALDIAYEKIHVHPEYKEFSNYK--YNDIAIIRLKHPVSFTHFVMPICLPNKSEPL 285
            |...|            |:.:|..:    ||:  .|::|::.|......|:.:..||||.:...|
  Fly   114 EAFVL------------KMVIHKSF----NYQRGANNLALLFLDREFPLTYKINTICLPTQKRSL 162

  Fly   286 TLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGE 350
            :   .....|:|||:....:.::..:...|.|.:...::..:...|...|....|....||||||
  Fly   163 S---STRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGE 224

  Fly   351 FAKDTCAGDSGGPLMY-FDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRK 414
            ...|.|.||.||.|.. ......::...|:|::| ..|.....||.||:|.|:..||   |||.|
  Fly   225 KDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWG-VGCKEKNVPATYTDVFEFKPWI---VQQIK 285

  Fly   415 KSQQTQD 421
            ::..|.|
  Fly   286 ENLYTPD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 68/250 (27%)
Tryp_SPc 150..409 CDD:238113 70/253 (28%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 71/256 (28%)
Tryp_SPc 50..280 CDD:214473 68/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.