DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG31205

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:305 Identity:80/305 - (26%)
Similarity:122/305 - (40%) Gaps:76/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 IQTVEPS-SGFNLLNECG----KQVTNRIYGGE--IAELDEFPWLALLV----YNSNDYGCSGAL 180
            |.|:.|: ...::..|||    ||     |..:  |||..|.||:..:|    ..||...|:|.|
  Fly    13 ITTLHPTIQAASVGQECGIFNEKQ-----YNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGIL 72

  Fly   181 IDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHP 245
            ||.|.::||||||..:   :.:.:..|..|:                  :|::.......:.|||
  Fly    73 IDSRRVVTAAHCVSKD---ESESIYGVVFGD------------------SDSSNINLVSAVTVHP 116

  Fly   246 EY--KEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSE--PLTLAEGQMFSVSGWGRTDLFNK 306
            :|  ::|.    ||:|||.|...|.|:..|.|||||:.||  |.:........|:|     |...
  Fly   117 DYSPRKFE----NDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAG-----LEGP 172

  Fly   307 YFINIHSPI-----KLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGD-----SG 361
            .|...||..     ::|:....:.::.|.:....|...|    ||  |...:...:|.     ||
  Fly   173 SFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEEL----IC--GHTERSPLSGSALTEASG 231

  Fly   362 GPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            .|..:.        ..|:...||....:..:.  |.|:..:.|||
  Fly   232 TPRQFH--------LLGIAVAGFFSSDLDHQG--YLNIRPHLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 70/276 (25%)
Tryp_SPc 150..409 CDD:238113 72/277 (26%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 46/148 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.