DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and sphinx1

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:284 Identity:62/284 - (21%)
Similarity:104/284 - (36%) Gaps:75/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 QVTNRIYGGEIAELDEFPWLALLVY-----NSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGL 204
            :::.||.||..|:.....:|..:||     :|.:|| :|.:|.::.|||                
  Fly    21 KLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYG-AGTIISNQWILT---------------- 68

  Fly   205 KHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPE-----------YKEFSNYKY-ND 257
                     |||                .|..:|.::|:...           |||...:.| ||
  Fly    69 ---------VKT----------------VLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDND 108

  Fly   258 IAIIRLKHPV-SFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLK-LR 320
            ..|..:|.|. .|...:..:.:|..........|.|..|.|:|......|.      |..:: :.
  Fly   109 HVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKL------PEWMRCIE 167

  Fly   321 IPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFT 385
            :..::|..|.|    :...|...::|..||..|..|.||.||.::......:   ..|::.....
  Fly   168 VEVMNNTECAK----YYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPT---FIGIIWLMPE 225

  Fly   386 QCGMAGKPAVYTNVAEYTDWIDSV 409
            .|.: |.|:|:..|:::..||..|
  Fly   226 NCSI-GYPSVHIRVSDHIKWIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 59/275 (21%)
Tryp_SPc 150..409 CDD:238113 60/277 (22%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 59/275 (21%)
Tryp_SPc 26..248 CDD:304450 60/277 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.