DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Tpsg1

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:303 Identity:88/303 - (29%)
Similarity:118/303 - (38%) Gaps:78/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PSSGFNLL---NECGK-QVT---NRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTA 189
            |..||.||   ..||: ||:   :||.||..|:...:||.|.|.. ...:.|.|:|:....:|||
  Rat     5 PYCGFLLLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLRL-QKVHVCGGSLLSPEWVLTA 68

  Fly   190 AHCVQGE-GVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNY 253
            |||..|. ...|.:    |.|||..:...|                              .||..
  Rat    69 AHCFSGSVNSSDYE----VHLGELTITLSP------------------------------HFSTV 99

  Fly   254 KY--------------NDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLF 304
            |.              .|||:::|..||:.:..|.|:|||..|  .....|....|:|||.|   
  Rat   100 KQIIMYSSAPGPPGSSGDIALVQLATPVALSSQVQPVCLPEAS--ADFHPGMQCWVTGWGYT--- 159

  Fly   305 NKYFINIHSPIK-----LKLRIPYVSNENCTKILEGF-GVRLGPKQICAGGEFAKDTCAGDSGGP 363
                 ....|:|     .:.::..|..|.|::..... |..:....:||.|  ..|.|..|||||
  Rat   160 -----QEGEPLKPPYNLQEAKVSVVDVETCSQAYSSSNGSLIQSDMLCAWG--PGDACQDDSGGP 217

  Fly   364 LMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            |:.  |....|...||||:| ..||...:|.||..|..|.:||
  Rat   218 LVC--RVAGIWQQAGVVSWG-EGCGRPDRPGVYARVTAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 77/277 (28%)
Tryp_SPc 150..409 CDD:238113 78/278 (28%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 77/277 (28%)
Tryp_SPc 30..260 CDD:238113 78/278 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.