DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Tpsb2

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:276 Identity:91/276 - (32%)
Similarity:129/276 - (46%) Gaps:44/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IYGGEIAELDEFPWLALLVYNSN--DYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGE- 211
            |.||..|...::||...|.:..:  .:.|.|:||..:.:|||||||         || |::..| 
  Rat    30 IVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV---------GL-HIKSPEL 84

  Fly   212 FNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPI 276
            |.|:.      ...||..||..|.:  .:..|||.|  ::.....|||::.|::||:.:..:.|.
  Rat    85 FRVQL------REQYLYYADQLLTV--NRTVVHPHY--YTVEDGADIALLELENPVNVSTHIHPT 139

  Fly   277 CLPNKSEPLTLAEGQMFSVSGWGRTD----LFNKYFINIHSPIKLKLRIPYVSNENC-----TKI 332
            .||..||  |...|....|:|||..|    |...|      |:| ::::|.|.|..|     |.:
  Rat   140 SLPPASE--TFPSGTSCWVTGWGDIDSDEPLLPPY------PLK-QVKVPIVENSLCDRKYHTGL 195

  Fly   333 LEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYT 397
            ..|..|.:....:...|....|:|.|||||||:.  :....|:..||||:| ..|..|.:|.:||
  Rat   196 YTGDDVPIVQDGMLCAGNTRSDSCQGDSGGPLVC--KVKGTWLQAGVVSWG-EGCAEANRPGIYT 257

  Fly   398 NVAEYTDWIDSVVQQR 413
            .|..|.|||...|.||
  Rat   258 RVTYYLDWIHRYVPQR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 86/267 (32%)
Tryp_SPc 150..409 CDD:238113 88/270 (33%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 88/269 (33%)
Tryp_SPc 30..266 CDD:214473 86/267 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346342
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.