DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and F10

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:423 Identity:115/423 - (27%)
Similarity:171/423 - (40%) Gaps:87/423 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CDIPNETKRGVCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEVEQQVSEAQGSYESLVCCPAN 92
            |....|.:.|:......|....:.:|. .|...|:..|....|  :|...|.|   .|:||..|.
  Rat    95 CQNQGECRDGLGSYTCTCTEGFEGKNC-ELFVRKLCSLDNGDC--DQFCREEQ---NSVVCSCAK 153

  Fly    93 GQDYLFPVLQFSKFEYRRFLDVTARF-----KRKKLKRRI----------------------QTV 130
            |        .|...:.:..|. ||.|     .:.:.||.:                      .|.
  Rat   154 G--------YFLGNDGKSCLS-TAPFPCGKTNKGRAKRSVALNTSNSEPDPEDLMPDADILYPTE 209

  Fly   131 EPSSGFNLLN---ECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYG-CSGALIDDRHILTAAH 191
            .||...||..   |.......||.||:..:..|.||.|||..:....| |.|.::::.:||||||
  Rat   210 SPSELLNLNKTEPEANSDDVIRIVGGQECKRGECPWQALLFSDEETDGFCGGTILNEFYILTAAH 274

  Fly   192 CVQGEGVRDRQGLKHVRLGEFNVKTEP--DCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYK 254
            |:. :..|.:     ||:|:.|.:.|.  :.:.|.:.:.                 ::.:|....
  Rat   275 CLH-QAKRFK-----VRVGDLNTEQEDGGEMVHEVDMII-----------------KHNKFQRDT 316

  Fly   255 YN-DIAIIRLKHPVSFTHFVMPICLPNKS-EPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKL 317
            |: |||::|||.|::|...|.|.|||.|. ...||...:...|||:|||....:     .|.:..
  Rat   317 YDFDIAMLRLKTPITFRENVAPACLPQKDWAEATLMTQKTGIVSGFGRTHEKGR-----QSKVLK 376

  Fly   318 KLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAK--DTCAGDSGGPLMYFDRQHSRWVAYGVV 380
            .:.:|||....| ::...|.:.  ....|||.: ||  |.|.||||||  :..|....:...|:|
  Rat   377 MMEVPYVDRNTC-RLSTSFSIT--QNMFCAGYD-AKQEDACQGDSGGP--HVTRFKDTYFVTGIV 435

  Fly   381 SYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQR 413
            |:| ..|...||..:||.|..:..|||..::.|
  Rat   436 SWG-EGCARKGKYGIYTKVTAFLKWIDRSMKAR 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855 14/60 (23%)
Tryp_SPc 149..406 CDD:214473 81/263 (31%)
Tryp_SPc 150..409 CDD:238113 83/265 (31%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011 5/27 (19%)
FXa_inhibition 129..164 CDD:405372 11/47 (23%)
Tryp_SPc 232..462 CDD:238113 82/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.