DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and f10

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:390 Identity:109/390 - (27%)
Similarity:169/390 - (43%) Gaps:99/390 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CEVEQQVSEAQGSYESLVCCPANG------------QD-----YLFPVLQFSKFEYRRFLDVTAR 117
            |||.:         :::||..|||            ||     .::|....|.|.:...:..:..
Zfish   137 CEVME---------KNVVCSCANGYELAPNGKSCQSQDPFKCGVIYPKKTRSIFFHTPNITESEN 192

  Fly   118 FKRKKLKRRIQTVEPSSGFNLLNECGKQVTN-------------------------RIYGGEIAE 157
            .:..:|:   .|:||.  :|..|....|..:                         ||..|....
Zfish   193 EEETELE---ATIEPV--YNHSNPLNNQTDSMFGLHELEIIEEEPILPVVSTAGDGRIVNGVECP 252

  Fly   158 LDEFPWLALLVYNSNDYG-CSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCI 221
            ..:.||.|||: |.|:.| |.|.::.:..||:||||: .|.:..|     |.:||::.     .:
Zfish   253 PGDCPWQALLI-NENNMGFCGGTILTEHFILSAAHCM-NESLSIR-----VVVGEYDT-----LV 305

  Fly   222 EEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLT 286
            .|..     :|..|:  ::|.:|..|:. ..| :||||:|:|..|:.||.:::|.|||.    :.
Zfish   306 PEGR-----EATHDV--DEILIHKNYQP-DTY-HNDIALIKLSKPIKFTKYIIPACLPE----MK 357

  Fly   287 LAEGQMFS-----VSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQIC 346
            .||..:..     |||:||....     .:.|.|..||.:|||:...|   :|....::..:..|
Zfish   358 FAERVLMQQDDGLVSGFGRVREG-----GLSSTILQKLTVPYVNRAKC---IESSNFKISGRMFC 414

  Fly   347 AG-GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVV 410
            || .:..||.|.||||||  :..|..:.|...||||:| ..|...||..|||.|::|..||::.:
Zfish   415 AGYDQEEKDACQGDSGGP--HVTRFKNTWFITGVVSWG-EGCARKGKYGVYTQVSKYIMWINNAM 476

  Fly   411  410
            Zfish   477  476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855 4/18 (22%)
Tryp_SPc 149..406 CDD:214473 87/263 (33%)
Tryp_SPc 150..409 CDD:238113 88/265 (33%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342 8/32 (25%)
Tryp_SPc 244..472 CDD:214473 87/263 (33%)
Tryp_SPc 245..474 CDD:238113 88/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.