DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG33461

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:297 Identity:91/297 - (30%)
Similarity:144/297 - (48%) Gaps:50/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 VEPSSGFNLLNECG--KQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHC 192
            |..||...|...||  .:::.:|..|..|.|..:||:|.| :....:.|:|:||:...:||:|||
  Fly    20 VHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFL-HTPTYFLCAGSLINQWFVLTSAHC 83

  Fly   193 VQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEY--KEFSNYKY 255
            ::.    |.:.:  .||||.|...:.||  |.|  .|.:|..:...:.:..|..|  |:||    
  Fly    84 IED----DVELI--ARLGENNRDNDIDC--ENN--RCLEATQEYNVDMLFKHRLYDPKDFS---- 134

  Fly   256 NDIAIIRLKHPVSFTHFVMPICL-PNKSEPLTLAEGQMFSVSGWG--RTDLFNKYFINIHSPIKL 317
            |||.::||:..|.:|:.:.|||: .::...|.:.:...|..:|||  .|||..|     .|.:.:
  Fly   135 NDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTK-----SSRVLM 194

  Fly   318 KLRIPYVSNENCTKI-----LEGFGVRLGPKQICAGGEFAKDTCAGDSGGP----LMYFDRQHSR 373
            :|.:......:|.:|     |.|        |||||.:.. :.|.||||||    ::.|..:  |
  Fly   195 ELNLYRRPRNDCARIFKQNFLSG--------QICAGNDDG-NLCRGDSGGPQGRYVLIFGMK--R 248

  Fly   374 WVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVV 410
            :|..|:.|:.:..|   .|.::.|:|..|..||..||
  Fly   249 FVQMGIASFTYENC---SKVSILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 81/270 (30%)
Tryp_SPc 150..409 CDD:238113 83/272 (31%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 81/270 (30%)
Tryp_SPc 42..281 CDD:238113 83/272 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26418
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.