DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and TPSG1

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:282 Identity:90/282 - (31%)
Similarity:131/282 - (46%) Gaps:42/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PSSGFNLLNECGK-QVTN---RIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHC 192
            ||| |:|  .||: ||::   ||.||..|....:||.|.|... ..:.|.|:|:..:.:||||||
Human    44 PSS-FDL--GCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLR-RVHVCGGSLLSPQWVLTAAHC 104

  Fly   193 VQGE-GVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYN 256
            ..|. ...|.|    |.|||..:...|       :.|.....:      :|..|..:..::   .
Human   105 FSGSLNSSDYQ----VHLGELEITLSP-------HFSTVRQII------LHSSPSGQPGTS---G 149

  Fly   257 DIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLK-LR 320
            |||::.|..||:.:..::|:|||..|:  ....|....|:|||    :.:....:..|..|: ::
Human   150 DIALVELSVPVTLSSRILPVCLPEASD--DFCPGIRCWVTGWG----YTREGEPLPPPYSLREVK 208

  Fly   321 IPYVSNENCTKILEG-FGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGF 384
            :..|..|.|.:...| .|..|.|..:||.|  ..|.|..||||||:.  :.:..||..|.||:| 
Human   209 VSVVDTETCRRDYPGPGGSILQPDMLCARG--PGDACQDDSGGPLVC--QVNGAWVQAGTVSWG- 268

  Fly   385 TQCGMAGKPAVYTNVAEYTDWI 406
            ..||...:|.|||.|..|.:||
Human   269 EGCGRPNRPGVYTRVPAYVNWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 79/259 (31%)
Tryp_SPc 150..409 CDD:238113 80/260 (31%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 79/259 (31%)
Tryp_SPc 63..293 CDD:238113 80/260 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.