DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG30323

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:274 Identity:53/274 - (19%)
Similarity:95/274 - (34%) Gaps:82/274 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NDYGCSGALIDDRHILTAAHCV--QGEGVRDR-QGLKHVRLGEFNVKTEPDCIEEP---NYLSCA 230
            :::.|:|:|:....::|:..||  :.|...:: ...|::|:..|.    |..:::|   |.....
  Fly    50 DNHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFT----PKRLKKPSPKNIYHVQ 110

  Fly   231 DAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSV 295
            ...||             |.:.....::|:::|...|:...|.|  .||.|.    |....:.:.
  Fly   111 KIVLD-------------ESAISGCTELALLKLDRGVTGQRFAM--MLPEKE----LNSTWLCNS 156

  Fly   296 SGWGRTDLFNKYFINIHSP------------------------IKLKLRIPYVSNENCTKIL--- 333
            .||||....:..:|:...|                        |:.:....|....:|::.|   
  Fly   157 LGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMT 221

  Fly   334 --EGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVY 396
              .|.|                :.|..|.|.|| :.|.     ..|||.....| |...|. ..|
  Fly   222 SYTGRG----------------NMCQQDLGSPL-FCDH-----FLYGVARRVHT-CDDEGF-MFY 262

  Fly   397 TNVAEYTDWIDSVV 410
            ||:.:...:|:..:
  Fly   263 TNIYQNRKFIEDTL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 52/268 (19%)
Tryp_SPc 150..409 CDD:238113 53/271 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 53/271 (20%)
Tryp_SPc 45..272 CDD:214473 52/268 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.